PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010101639.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family Dof
Protein Properties Length: 342aa    MW: 37025.6 Da    PI: 7.651
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010101639.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.47.5e-393291261
          zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                    +++alkcprCds ntkfCyynny+lsqPr+fCk+CrryWtkGG lrnvPvGgg+rk k+s
  XP_010101639.1 32 PQAALKCPRCDSLNTKFCYYNNYNLSQPRHFCKNCRRYWTKGGVLRNVPVGGGCRKTKRS 91
                    67899****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-273286IPR003851Zinc finger, Dof-type
PfamPF027013.8E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.6743690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MQDIHSVGGA RFFAAGGGGD RRLRPHHHHQ NPQAALKCPR CDSLNTKFCY YNNYNLSQPR  60
HFCKNCRRYW TKGGVLRNVP VGGGCRKTKR SKPKASSATS AVAATANSTP PPPPSQDRKS  120
NSHSSSESSS LTAATNTTAT ATEAVSAPSA SAGSNLMKMH QESKFFVAQS SPNPSFEAPP  180
SAPPSLLEQA GSDCGIFSEI GSFTSLIASS ATGAMPNFDY GSISDVSISP FRLNQNHHHQ  240
HHQHQAQQSQ SWHEQSQKVT MSVADDQELK MQEITGGLLD QTVQVDLSVL HDSRSNGAGF  300
GSLGDWQQCG DQALFDLPNT VDQSYWSQSQ WTDQDHPSLY PP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00570DAPTransfer from AT5G60850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0097693e-52AP009769.1 Lotus japonicus genomic DNA, clone: LjT13A22, TM1930, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010101639.10.0Dof zinc finger protein
TrEMBLW9RP280.0W9RP28_9R
STRINGVIT_17s0000g04850.t011e-83(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59983050
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60850.12e-33OBF binding protein 4